GJE1 (GJC3) Rabbit Polyclonal Antibody TA341680 from OriGene Technologies | Biocompare.com

Supplier Images

GJE1 (GJC3) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
GJE1 (GJC3) Rabbit Polyclonal Antibody

OriGene Technologies' GJE1 (GJC3) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The GJE1 (GJC3) Rabbit Polyclonal Antibody was generated using GJC3 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-GJE1 Antibody

Product Specs
ItemGJE1 (GJC3) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA341680
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetGJC3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-GJE1 antibody: synthetic peptide directed towards the C terminal of human GJE1. Synthetic peptide located within the following region: KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
NCBI Full Gene Namegap junction protein gamma 3
NCBI Gene AliasesCX31.3, CX29, CX30.2, GJE1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!